Loading...
Statistics
Advertisement

Welcome to AskTimTaylor.com
www.asktimtaylor.com/
Place your website description in this area. This is read by some search engines.

Asktimtaylor.com

Advertisement
Conversion Technology Metas Server
Asktimtaylor.com is hosted in United States / Burlington . Asktimtaylor.com uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 6. First javascripts: Header.js, Menu.js, Addthis_widget.js, Number of used analytics tools: 0. Its server type is: Apache/2.

Technologies in use by Asktimtaylor.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 6
  • header.js
  • menu.js
  • addthis_widget.js
  • social-links.js
  • copyright.js
  • copyright-allwebco.js

Server Type

  • Apache/2

Social

Number of occurences: 1
  • Add This

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Asktimtaylor.com

SSL certificate

    • name: /OU=GT37353352/OU=See www.rapidssl.com/resources/cps (c)14/OU=Domain Control Validated - RapidSSL(R)/CN=*.hostcentric.com
    • subject:
      • OU:
        • 0: GT37353352
        • 1: See www.rapidssl.com/resources/cps (c)14
        • 2: Domain Control Validated - RapidSSL(R)
      • CN: *.hostcentric.com
    • hash: 0c326730
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: RapidSSL SHA256 CA - G3
    • version: 2
    • serialNumber: 75854
    • validFrom: 141216124710Z
    • validTo: 160413085119Z
    • validFrom_time_t: 1418734030
    • validTo_time_t: 1460537479
    • extensions:
      • authorityKeyIdentifier: keyid:C3:9C:F3:FC:D3:46:08:34:BB:CE:46:7F:A0:7C:5B:F3:E2:08:CB:59
      • authorityInfoAccess: OCSP - URI:http://gv.symcd.com CA Issuers - URI:http://gv.symcb.com/gv.crt
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • subjectAltName: DNS:*.hostcentric.com, DNS:hostcentric.com
      • crlDistributionPoints: Full Name: URI:http://gv.symcb.com/gv.crl
      • basicConstraints: CA:FALSE
      • certificatePolicies: Policy: 2.16.840.1.113733.1.7.54 CPS: https://www.rapidssl.com/legal

Meta - Asktimtaylor.com

Number of occurences: 4
  • Name: Description
    Content: Place your website description in this area. This is read by some search engines.
  • Name: KeyWords
    Content: add, your, keywords and phrases in this area, separated, by, commas, this, is read by only a, few search, engines
  • Name:
    Content: text/html; charset=iso-8859-1
  • Name: Copyright
    Content: Allwebco Design Corporation http://allwebcodesign.com/

Server / Hosting

  • IP: 65.254.228.100
  • Latitude: 42.51
  • Longitude: -71.20
  • Country: United States
  • City: Burlington

Rname

  • ns2.hostcentric.com
  • ns1.hostcentric.com
  • mx.asktimtaylor.com

Target

  • dnsadmin.hostcentric.com

HTTP Header Response

HTTP/1.1 200 OK Date: Fri, 08 Apr 2016 18:19:32 GMT Content-Type: text/html Content-Length: 11101 Connection: keep-alive Keep-Alive: timeout=30 Server: Apache/2 Last-Modified: Thu, 11 Sep 2014 19:24:55 GMT ETag: "2b5d-502cf1fa34179" Accept-Ranges: bytes Cache-Control: max-age=3600 Expires: Fri, 08 Apr 2016 19:19:32 GMT

DNS

host: asktimtaylor.com
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 65.254.228.100
host: asktimtaylor.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns2.hostcentric.com
host: asktimtaylor.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns1.hostcentric.com
host: asktimtaylor.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns1.hostcentric.com
  5. rname: dnsadmin.hostcentric.com
  6. serial: 2006120967
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 3600
host: asktimtaylor.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 30
  5. target: mx.asktimtaylor.com
host: asktimtaylor.com
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: v=spf1 ip4:38.113.1.0/24 ip4:38.113.20.0/24 ip4:65.254.224.0/19 ?all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.sktimtaylor.com, www.aosktimtaylor.com, www.osktimtaylor.com, www.apsktimtaylor.com, www.psktimtaylor.com, www.a9sktimtaylor.com, www.9sktimtaylor.com, www.asktimtaylor.com, www.sktimtaylor.com, www.aisktimtaylor.com, www.isktimtaylor.com, www.ausktimtaylor.com, www.usktimtaylor.com, www.aktimtaylor.com, www.asektimtaylor.com, www.aektimtaylor.com, www.aswktimtaylor.com, www.awktimtaylor.com, www.asdktimtaylor.com, www.adktimtaylor.com, www.asxktimtaylor.com, www.axktimtaylor.com, www.asfktimtaylor.com, www.afktimtaylor.com, www.asgktimtaylor.com, www.agktimtaylor.com, www.astktimtaylor.com, www.atktimtaylor.com, www.astimtaylor.com, www.askttimtaylor.com, www.asttimtaylor.com, www.asktimtaylor.com, www.astimtaylor.com, www.askgtimtaylor.com, www.asgtimtaylor.com, www.askbtimtaylor.com, www.asbtimtaylor.com, www.askntimtaylor.com, www.asntimtaylor.com, www.askhtimtaylor.com, www.ashtimtaylor.com, www.askytimtaylor.com, www.asytimtaylor.com, www.askltimtaylor.com, www.asltimtaylor.com, www.askotimtaylor.com, www.asotimtaylor.com, www.askutimtaylor.com, www.asutimtaylor.com, www.askitimtaylor.com, www.asitimtaylor.com, www.askmtimtaylor.com, www.asmtimtaylor.com, www.askimtaylor.com, www.asktqimtaylor.com, www.askqimtaylor.com, www.asktaimtaylor.com, www.askaimtaylor.com, www.askt imtaylor.com, www.ask imtaylor.com, www.asktwimtaylor.com, www.askwimtaylor.com, www.askteimtaylor.com, www.askeimtaylor.com, www.asktzimtaylor.com, www.askzimtaylor.com, www.asktximtaylor.com, www.askximtaylor.com, www.asktcimtaylor.com, www.askcimtaylor.com, www.asktmtaylor.com, www.asktirmtaylor.com, www.asktrmtaylor.com, www.asktifmtaylor.com, www.asktfmtaylor.com, www.asktivmtaylor.com, www.asktvmtaylor.com, www.asktikmtaylor.com, www.asktkmtaylor.com, www.askti,mtaylor.com, www.askt,mtaylor.com, www.asktibmtaylor.com, www.asktbmtaylor.com, www.asktigmtaylor.com, www.asktgmtaylor.com, www.asktitmtaylor.com, www.askttmtaylor.com, www.asktiymtaylor.com, www.asktymtaylor.com, www.asktiumtaylor.com, www.asktumtaylor.com, www.asktijmtaylor.com, www.asktjmtaylor.com, www.asktimmtaylor.com, www.asktmmtaylor.com, www.asktinmtaylor.com, www.asktnmtaylor.com, www.asktitaylor.com, www.asktimptaylor.com, www.asktiptaylor.com, www.asktimotaylor.com, www.asktiotaylor.com, www.asktimitaylor.com, www.asktiitaylor.com, www.asktimktaylor.com, www.asktiktaylor.com, www.asktim.taylor.com, www.askti.taylor.com, www.asktimutaylor.com, www.asktiutaylor.com, www.asktimjtaylor.com, www.asktijtaylor.com, www.asktimntaylor.com, www.asktintaylor.com, www.asktim-taylor.com, www.askti-taylor.com, www.asktimaylor.com, www.asktimtqaylor.com, www.asktimqaylor.com, www.asktimtaaylor.com, www.asktimaaylor.com, www.asktimt aylor.com, www.asktim aylor.com, www.asktimtwaylor.com, www.asktimwaylor.com, www.asktimteaylor.com, www.asktimeaylor.com, www.asktimtzaylor.com, www.asktimzaylor.com, www.asktimtxaylor.com, www.asktimxaylor.com, www.asktimtcaylor.com, www.asktimcaylor.com, www.asktimtylor.com, www.asktimtaoylor.com, www.asktimtoylor.com, www.asktimtapylor.com, www.asktimtpylor.com, www.asktimta9ylor.com, www.asktimt9ylor.com, www.asktimtaylor.com, www.asktimtylor.com, www.asktimtaiylor.com, www.asktimtiylor.com, www.asktimtauylor.com, www.asktimtuylor.com, www.asktimtalor.com, www.asktimtayzlor.com, www.asktimtazlor.com, www.asktimtayalor.com, www.asktimtaalor.com, www.asktimtayslor.com, www.asktimtaslor.com, www.asktimtaydlor.com, www.asktimtadlor.com, www.asktimtaylor.com, www.asktimtalor.com, www.asktimtayclor.com, www.asktimtaclor.com, www.asktimtay lor.com, www.asktimta lor.com,

Other websites we recently analyzed

  1. Acceuil Michael.W.Savard
    Houston (United States) - 192.185.92.223
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 5
  2. naturaldogdeli.com
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  3. Home Page
    Dublin (Ireland) - 46.51.204.184
    Server software: nginx
    Technology: CloudFront, CSS, Google Font API, Html
    Number of Javascript: 5
    Number of meta tags: 5
  4. 9¸æž°è¡¾æ»ž
    Ottawa (Canada) - 47.90.10.47
    Server software: Apache
    Technology: CSS, Html, Iframe, Javascript, jQuery, Php
    Number of Javascript: 15
    Number of meta tags: 3
  5. drawwritenow.com
    Lansing (United States) - 67.225.133.85
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  6. İzmirdeki Tüm Mekan ve Dükkanlar - İzmir Evreni
    İzmirin Sanal Reklam Ağı İzmirdeki Tüm Dükkan ve Mekanların Reklamlarını Yayınlıyoruz.imagedummyipsumprintingindustrytextsimplypictureloremtypesettingreklamcafehediyelikhergdaapartfastfoodeyizantaindustryzmrdekindustrysiteindustrypreviousnextsampleamacimizeyaevrenielektrikelektronikbistrodkkancopyrightbacklinkayakkabclasspreviewenerjiakaryaktemlakaperatifevrenievrenevrenireklamreklamletmzmrdekszlemesiyasaltamaclkspotsitemapreklamlarnsayfazmrtantmtarihizccaciyezmiryurtwaffletekstilvizyonumuzpetotomamllerimarketzmirevrenicomdesignletiimkincikiralamamekanlarizmirdekimekanlarreklamreklamizmirzmrizmirnaatnakliyemimarlkmhendislikmekanlarzmirinjiyansimply dummydummy textprinting typesettinglorem ipsumtext printingipsum simplyheresample imageimage describedescribe imageindustry loremtypesetting industryimage heresamplehediyelik kozmetikhal ayakkabeyiz alverieya aydnlatmagaziemir sitemapgiyim naatelektronik mobilyaara kiralamaaperatif sporanta otomotivaksesuar nakliyeasanal reklambujiteri fastfoodelence tekstilclasspreview zmircafelerpreviousnextsample pictureevren amacimizindustrysite mapteknoloji elektriktantm yazlartamaclk mobilturizmtatil hertypesetting industrypreviousnextsampleyurt biliimykama zccaciyewaffle eitimkrtasiyeshop backlinksemtleriizmir tarihilanlari letmzmrdekjiyan kinogizlilikzmir evrenizmirzmirevrenizmirletiim gzellikbakmpastaneunlu mamllerireklamlarn yaynlyoruzsamplereklam zmirdekipicture loremimage herepreviousnextsampleimage heresample imageipsum simply dummyprinting typesetting industrydummy text printingsimply dummy textindustry lorem ipsumtypesetting industry loremindustrypreviousnextsample picture lorembistro pastaneunlu mamllerijiyan kinogizlilik szlemesiyasalcafe gaziemir sitemapimage herepreviousnextsample pictureclasspreview zmir evrenienerjiakaryakt turizmtatil hermekanlarzmirin sanal reklamtamaclk mobil ototantm yazlar pettypesetting industrypreviousnextsample picturewaffle eitimkrtasiye gdareklamlarn yaynlyoruzsample imageprinting typesetting industryzmrdekmekanlarreklamreklamizmirzmrizmir semtleriizmir tarihizmir evrenizmirzmirevrenizmir evrenievrenevrenireklamreklampicture lorem ipsumprinting typesetting industrysiteletiim gzellikbakm emlak
    Germany - 146.0.42.37
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Iframe, Javascript, jQuery Cycle, jQuery Fancybox, Php, SuperFish
    Number of Javascript: 16
    Number of meta tags: 10
  7. Danny's Pizza | A Great Restaurant in Douglas, Georgia
    Scottsdale (United States) - 184.168.165.1
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, SVG, WordPress Stats, Wordpress
    Number of Javascript: 14
    Number of meta tags: 4
  8. Agence Phiphi PLUS - Agence de Communication PHIPHI+
    Provo (United States) - 50.87.163.120
    G Analytics ID: UA-80660667-1
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php, Google Analytics, Joomla
    Number of Javascript: 14
    Number of meta tags: 3
  9. Welkom bij Toyota dealer Autobedrijf Alex van de Velde Zuidzande B.V.
    Dit is de officiële Toyota dealerwebsite van Autobedrijf Alex van de Velde Zuidzande B.V. met o.a. de (hybride) Toyota modellen, Occasions, Acties en Nieuws..
    Netherlands - 193.239.132.218
    Server software: Microsoft-IIS/8.5
    Technology: Carousel, CSS, Html, Html5, Javascript, Google Analytics
    Number of Javascript: 7
    Number of meta tags: 6
  10. Double Blessing International
    Provo (United States) - 162.144.23.71
    Server software: nginx/1.10.1
    Technology: CSS, Html
    Number of meta tags: 3

Check Other Websites